UNFUCG
DashboardSearchChatBookmarksNotificationsActivityPremiumProfile
?
Home
Search
Chat
Saved
Profile
Episode
These Foods Tank Testosterone, Lower Sperm Count
~18 min
Episode Brief·YouTube

These Foods Tank Testosterone, Lower Sperm Count

Mike Mutzel
Watch on YouTube Add to chat My bookmarks← All sources

TL;DR

The four things you'd lose by not watching

4 items

TL;DR

The four things you'd lose by not watching

4 items
1

A new randomized crossover trial found that isocaloric ultra-processed foods (UPF) cause greater fat gain, a trend toward lean mass loss, and hormonal disruption compared to whole foods, challenging the calories-in-calories-out model.

2

In just 3 weeks, a UPF diet significantly lowered testosterone, sperm motility, and morphology in reproductive-age men, and increased serum and semen levels of phthalates, PFAS, lead, and mercury.

3

Mike Mutzel endorses Joovv red light therapy (sponsor) for skin and testosterone, citing daily use since 2018 and a striking identical-twin anecdote.

4

60% of North American calories come from UPF and over 70% of the population is now obese, making the study’s findings on metabolic and reproductive harm highly relevant to public health.

Protocols

Concrete recipes — what, when, how much, and why

1 item

Daily Joovv Red Light Therapy for Skin and Hormones

WhatUse a Joovv medical-grade red light panel emitting near-infrared and infrared wavelengths at therapeutic intensity, applied daily.
WhenEvery day (as per Mike Mutzel's close contact who uses it daily, and his own routine since 2018).
DoseDaily exposure; follow device guidelines for distance and time. Mike emphasizes 'clinically proven wavelengths' and 'safe and effective dosages,' but does not specify minutes per session.
For whomSpeaker (anecdotal) and his close female contact. He presents it as beneficial for men seeking skin health and hormonal support.
WhyImproves skin appearance and may support testosterone production, based on Mike's personal before-and-after testosterone experiment and an identical-twin skin comparison.
CaveatsMike is a paid sponsor; results may vary. He notes other confounding lifestyle factors in the twin anecdote. Not a substitute for diet and lifestyle.

Mike has been using Joovv since 2018 and recounts a striking anecdote: a close person with an identical twin uses his Joovv panel daily; her skin appears markedly younger than her twin's despite other variables. He also did a personal testosterone experiment documented on his channel where he measured before and after, suggesting a positive effect. He positions Joovv as a clinically-backed, modular system that allows users to start small and expand for full-body coverage. He appreciates that the wavelengths are precisely in the therapeutic range with verified intensity, making it 'actually really work' as opposed to cheaper alternatives.

Mechanism

The device delivers red and near-infrared light within clinically proven therapeutic windows that Mike says are exactly at the right intensity. He indicates this light energy improves skin quality and may positively influence hormone production, as suggested by his personal testosterone test. He does not detail cellular pathways but stresses that using correct wavelengths and medical-grade intensity is crucial for real-world results.

Personal experience

I've been using the Joovv red light therapy since 2018... She is a zealot when it comes to infrared light therapy and near-infrared light therapy, and her skin looks completely different compared to her identical twin.

What I like about what Joovv does is they offer the wavelengths in the therapeutic range at the right intensity. So this actually really works.

Also said
“I did a fun personal testosterone experiment where I did a before-and-after video...”— Demonstrates he personally tested the device for a male-specific hormonal benefit.
“They have clinically proven wavelengths of light, safe and effective dosages of light, and this is a true medical-grade panel.”— Technical validation of product quality and effectiveness.
“It's modular, so you can just add in another panel as your budget allows.”— Practical scalability and affordability note for consumers.

What's new

Personal practice updates, fresh positions, predictions

3 items

isocaloric-upf-body-composition

Even when calories and macros were matched, a 3-week diet of ultra-processed foods led to increased body weight, fat mass, and a trend toward decreased lean mass compared to unprocessed foods, directly contradicting the strict CICO model.

Why this matters: The study’s crossover design and washout period show that the ultra-processed nature of food alone—not calories or macros—drives worse body composition. Mike calls it a challenge to the conventional dogma and specifically points to proponents like Layne Norton to explain the discrepancy.

Background

For years, many nutrition influencers have argued that body composition is purely about energy balance (CICO). This trial provides controlled evidence that food quality independently influences fat storage and muscle maintenance.

The study involved 43 males of reproductive age, with each participant undergoing both a 3-week unprocessed food diet and a 3-week ultra-processed food diet separated by a 12-week washout. In the adequate-calorie arms, the processed food group still gained more body weight and fat mass. Even in the excess-calorie arms, those eating whole foods gained less fat and showed a trend toward better lean mass retention. This flies in the face of the strict energy balance model, as the researchers themselves stated: 'calories from unprocessed or ultra-processed foods are not equally stored or metabolized even when controlled for macronutrient load.' Mike Mutzel points to the potential catabolic effect of insulin resistance despite insulin being an anabolic hormone, speculating that the supraphysiological insulin spikes from UPF might paradoxically lead to muscle loss in some individuals. He connects this to the broader statistics that 60% of North American calories come from UPF and 73% of Americans are now obese, suggesting these findings are highly relevant to public health.

our study provides evidence that calories from unprocessed or ultra-processed foods are not equally stored or metabolized even when controlled for macronutrient load.

Also said
“There was a difference, you know, between-group differences when people ate isocaloric amounts of unprocessed foods versus isocaloric amounts of unprocessed junk food.”— Reinforces that isocaloric does not mean metabolically equal.
“This I would love for Layne Norton to try to like explain here.”— Direct call-out to a leading CICO advocate, highlighting the contrarian implication.
“There was a trend towards declining lean mass even in excess calories when you're comparing whole foods versus processed foods.”— Suggests impaired nutrient partitioning on a UPF diet, independent of energy surplus.

upf-environmental-toxins

Serum and semen analyses showed significant increases in lead, mercury, phthalates, and perfluoroalkyl chemicals after 3 weeks on an ultra-processed diet compared to an isocaloric unprocessed diet, revealing a rapid toxin load from food processing and packaging.

Why this matters: This provides a direct, short-term mechanism by which UPF may impair fertility and health beyond macronutrient composition—endocrine-disrupting chemicals entering the bloodstream and semen quickly.

Background

Persistent organic pollutants are known to accumulate in fatty foods and packaging, but this study demonstrates that even a brief dietary shift can measurably increase blood and semen levels, underscoring the immediate impact of food choices on reproductive fluids.

The study measured environmental contaminants in both serum and semen. Figures showed marked elevation of heavy metals (mercury, lead) and phthalates as well as PFAS in the UPF arm, while the unprocessed arm did not exhibit these spikes. Mike Mutzel notes these chemicals are 'laden with persistent organic pollutants' due to food processing, packaging, and agricultural residues. He underscores that these toxins not only disrupt endocrine function but also can directly affect sperm quality. The rapid appearance in semen is particularly concerning for reproductive health, and he suggests this is an independent reason to avoid UPF, separate from palatability or glycemic effects.

Look at figure four when we look at heavy metals like mercury, when we look at heavy metals like lead, those all increased as well as phthalates and the perfluoroalkyl chemicals... So there were significant increases and these were looked at in the serum as well as the semen.

Also said
“Ultra-processed foods are just not healthy, right? They're going to lower your testosterone, lower sperm motility, change the ratio between LDL and HDL, increase body fat mass...”— Summarizes the multi-system harm of UPF observed in this study.
“Most of these changes occurred in the blood, particularly the heavy metals.”— Clarifies that blood is the primary medium for heavy metal accumulation.

upf-male-fertility

The trial found statistically significant reductions in testosterone, follicle-stimulating hormone, sperm motility, sperm morphology, and semen volume on the UPF diet, independent of calorie intake, indicating direct reproductive toxicity.

Why this matters: Many couples attribute infertility to female factors, but this crossover study gives causal evidence that a man's diet quality alone can dramatically worsen sperm parameters in just weeks.

Background

Observational studies previously linked poor diet to lower sperm quality, yet the controlled crossover design provides strong evidence that the ultra-processed food matrix itself—not just excess calories or obesity—drives the decline in male fertility markers.

Mike opens the video stressing that men often assume fertility issues are their partner's fault, but this study flips that notion. The researchers observed marked declines in all sperm parameters alongside lower testosterone, even when the UPF diet was isocaloric and the participants were lean. He notes the rise in insulin and C-peptide on the UPF diet, suggesting insulin resistance may play a role, but the independent effect of processing could involve inflammation (increased CRP and interleukins) and the environmental chemicals previously described. He emphasizes that for anyone trying to conceive, switching to a whole foods diet for at least 3 weeks could be critical.

There was a marked decline in sperm motility and sperm morphology and actually changes in sperm volume was reduced as well as a reduction in follicle-stimulating hormone. And there was some statistical significant changes in testosterone.

Also said
“Many people think like, look, the reason why we can't have a child ... is because it's my wife's fault... But we have this new crossover study comparing unprocessed to ultra-processed foods.”— Frames the fertility discussion around men, a perspective often overlooked.
“If you're trying to conceive a healthy child, right? Then you want to go on a whole, you know, a real foods diet and not eat ultra-processed food and junk food.”— Direct actionable advice drawn from the fertility findings.

Recommendations

Products, supplements, and tools mentioned in the episode

1 item

Switch to an Unprocessed Whole Foods Diet (Avoid Ultra-Processed Foods)

Practice

Based on the reviewed study, Mike urges men, especially those trying to conceive, to replace ultra-processed foods with whole, unprocessed foods to improve body composition, reduce environmental toxin exposure, and raise testosterone and sperm quality.

The study demonstrates that the negative effects of UPF are independent of calorie load: isocaloric whole food diets led to better body composition, lower insulin, reduced heavy metals in blood and semen, and improved male fertility parameters. Mike notes that 60% of North American calories come from UPF and over 70% of the population is now obese, making this a pressing public health issue. He argues that the CICO model fails to account for these findings and that the food matrix, chemical contaminants, and insulinogenic effects of UPF cause harm regardless of energy balance. The recommendation is to adopt the dietary pattern used in the study's whole-food arm—real, minimally processed foods—for at least several weeks to see metabolic and reproductive benefits.

vs alternatives

Contrasts with the 'if it fits your macros' approach, which ignores food processing and toxin load. Mike emphasizes that not all calories are metabolically equal.

If you're trying to conceive a healthy child, right? Then you want to go on a whole, you know, a real foods diet and not eat ultra-processed food and junk food.

Also said
“This stuff is just not safe and we shouldn't be consuming this and we absolutely should not be letting our children eat these foods because they are unhealthy.”— Emphatic warning about UPF's broader harms.
Find Switch
Disclosed sponsorships1speaker disclosed

Joovv Red Light Therapy Panels

Product Sponsored · disclosed

Mike recommends Joovv for skin rejuvenation and testosterone support, highlighting its precise therapeutic wavelengths, medical-grade build, and modular design.

DisclosureMike thanks Joovv as the video's sponsor and provides a discount link: joovv.com/mike with code HIH.

Mike endorses Joovv as a superior red light therapy product because it delivers the exact clinically proven wavelengths at safe and effective intensities, unlike many generic red lights. He describes his own use since 2018, including a before-and-after testosterone experiment, and a powerful anecdote where a close female relative who uses it daily looks markedly younger than her identical twin. The modular design allows users to start with one panel and expand to full-body coverage over time.

vs alternatives

Mike implies that many other red light products lack the correct intensity or therapeutic wavelengths, making them ineffective, whereas Joovv’s medical-grade panels deliver clinically proven results.

Personal experience

I've been using the Joovv red light therapy since 2018... her skin looks completely different compared to her identical twin... I did a fun personal testosterone experiment.

What I like about what Joovv does is they offer the wavelengths in the therapeutic range at the right intensity. So this actually really works.

Also said
“They have clinically proven wavelengths of light, safe and effective dosages of light, and this is a true medical-grade panel.”— Highlights product quality and safety.
“It's modular, so you can just add in another panel as your budget allows.”— Addresses cost and scalability.
Find Joovv

Notable quotes

Lines worth pulling out — contrarian, specific, or perfectly phrased

5 items
Surprise, surprise, ultra-processed foods impact male fertility and lower testosterone.
Sarcastic opening hook that frames the entire video's core message.
It really flies in the face of the conventional dogma when it comes to calories in calories out.
Directly challenges the dominant CICO paradigm, making the study’s implications clear and provocative.
Her skin looks completely different compared to her identical twin.
Powerful anecdotal evidence for red light therapy's efficacy, leveraging a natural controlled comparison (twins).
About six in 10 calories that people consume in North America comes from ultra-processed foods.
Stark statistic that contextualizes the public health relevance of the UPF discussion.
There was a marked decline in sperm motility and sperm morphology and actually changes in sperm volume was reduced as well as a reduction in follicle-stimulating hormone.
Concrete, alarming reproductive endpoint that many men may not associate with diet.

Sign in to share feedback

Tell us if this brief hit the mark or missed it — feedback feeds back into the next iteration of the prompt.

Topics covered

ultra-processed-foodsmale-fertilitytestosteronesperm-qualitybody-compositioncalories-in-calories-outinsulin-resistancered-light-therapyjoovvenvironmental-toxinsphthalatesheavy-metalsperfluoroalkyl-chemicalswhole-foods-dietrandomized-crossover-trialendocrine-disruptorsmetabolic-healthobesity-statistics
Free account

Make this library yours

Reading is free for everyone. A free account adds the personal layer: save protocols, follow experts, and see how the other experts weigh in on this same topic.

Create a free accountSign in

Where the experts disagree — weekly

One email a week: the sharpest new disagreements and protocols from the library. No spam, unsubscribe anytime.

Educational summary of the cited expert source — not medical advice. Open the source recording linked above and consult a qualified physician before acting on any protocol.